Sialin/SLC17A5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159788

Catalog No. NBP159788

Description

Sialin/SLC17A5 Polyclonal specifically detects Sialin/SLC17A5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Sialin/SLC17A5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ASTSodium/sialic acid cotransporter, FLJ22227, FLJ23268, ISSD, Membrane glycoprotein HP59, NSD, SD, sialic acid storage disease, SIALIN, SIASD, SLDSolute carrier family 17 member 5, solute carrier family 17 (anion/sugar transporter), member 5, solute carrier family 17, member 5
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26503
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q9NRA2
• Gene Symbols: SLC17A5
• Immunogen: Synthetic peptides corresponding to SLC17A5(solute carrier family 17 (anion/sugar transporter), member 5) The peptide sequence was selected from the N terminal of SLC17A5. Peptide sequence LFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLS
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Isotype: IgG

For Research Use Only