Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SIDT2 Rabbit anti-Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191551

Catalog No. NBP191551


Add to cart

Description

Description

SIDT2 Polyclonal antibody specifically detects SIDT2 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit samples. It is validated for Western Blot, Immunohistochemistry.
Specifications

Specifications

SIDT2
Unconjugated
PBS & 2% Sucrose. with 0.09% Sodium Azide
Affinity Purified
SIDT2
Synthetic peptide directed towards the N terminal of human SIDT2. Peptide sequence LNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPPT.
Immunogen affinity purified
RUO
Primary
51092
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Immunohistochemistry, Western Blot
Western Blot 1:1000, Immunohistochemistry
NP_001035545
DKFZp686L17253, FLJ90656, SID1 transmembrane family member 2, SID1 transmembrane family, member 2, UNQ685/PRO1325
Rabbit
IgG
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Bovine: 100%; Guinea pig: 100%; Human: 100%; Pig: 100%; Canine: 92%; Equine: 92%; Mouse: 92%; Rabbit: 92%; Rat: 92%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only