sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae), Mouse, Clone: 7B7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SIRT1.

Supplier:  Abnova Corporation H00023411M01

Catalog No. 89-015-851

Description

This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Sequence: NRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS

Specifications

• Antigen: sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae)
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC012499
• Gene Symbols: SIRT1
• Immunogen: SIRT1 (AAH12499, 456 a.a. ∼ 555 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 7B7
• Description: Mouse monoclonal antibody raised against a partial recombinant SIRT1.
• Gene: SIRT1
• Gene Alias: SIR2L1
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23411
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ