sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-015-822	50 μL

Catalog No. 89-015-822 Supplier Abnova Corporation Supplier No. H00023411A01

Description

Mouse polyclonal antibody raised against a partial recombinant SIRT1.

This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Alternative splicing results in multiple transcript variants. [provided by RefSeq

Sequence: NRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS

Specifications

• Antigen: sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SIRT1.
• Formulation: 50% glycerol
• Gene: SIRT1
• Gene Accession No.: BC012499
• Gene Alias: SIR2L1
• Gene Symbols: SIRT1
• Host Species: Mouse
• Immunogen: SIRT1 (AAH12499, 456 a.a. ∼ 555 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 23411
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum