Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SIVA1, apoptosis-inducing factor, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human SIVA protein.

Manufacturer:  Abnova Corporation H00010572B01P

Catalog No. 89-017-006


  Check Availability
Add to cart

Specifications

Description

This gene encodes a protein with an important role in the apoptotic (programmed cell death) pathway induced by the CD27 antigen, a member of the tumor necrosis factor receptor (TFNR) superfamily. The CD27 antigen cytoplasmic tail binds to the N-terminus of this protein. Two alternatively spliced transcript variants encoding distinct proteins have been described. [provided by RefSeq

Sequence: MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRPVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET
Description & Specifications

Specifications

SIVA1, apoptosis-inducing factor
Unlabeled
In 1X PBS, pH 7.4
BC034562
CD27BP, SIVA, Siva-1, Siva-2
Murine
Protein A column
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
Western Blot
SIVA1, apoptosis-inducing factor
SIVA1
Affinity Purified
SIVA1
SIVA (AAH34562, 1 a.a. ∽111 a.a) full-length human protein.
50μg
Apoptosis
Primary
10572
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit