Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SLC13A2.

Manufacturer:  Abnova Corporation H00009058A01

Catalog No. 89-004-418


Add to cart

Description

Description

Sequence: AMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQEPSPQKEVTKLDNGQALPVTSASSEGRAHLSQKHLHLTQC
Specifications

Specifications

solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2
Unconjugated
50% glycerol
NM_003984
NADC1|NaDC-1
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
9058
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant SLC13A2.
SLC13A2
Serum
SLC13A2
SLC13A2 (NP_003975, 146 a.a. ~ 220 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit