solute carrier family 18 (vesicular monoamine), member 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SLC18A2.

Manufacturer:  Abnova Corporation H00006571A01

Catalog No. 89-004-312

Description

The vesicular monoamine transporter acts to accumulate cytosolic monoamines into synaptic vesicles, using the proton gradient maintained across the synaptic vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine (Peter et al., 1993 [PubMed 7905859]). See also SLC18A1 (MIM 193002).[supplied by OMIM

Sequence: HEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGL

Specifications

• Antigen: solute carrier family 18 (vesicular monoamine), member 2
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_003054
• Gene Alias: MGC120477|MGC120478|MGC26538|SVAT|SVMT|VAT2|VMAT2
• Host Species: Mouse
• Quantity: 50 uL
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Primary or Secondary: Primary
• Gene ID (Entrez): 6571

• Applications: ELISA, Western Blot
• Description: Mouse polyclonal antibody raised against a partial recombinant SLC18A2.
• Gene: SLC18A2
• Format: Serum
• Gene Symbols: SLC18A2
• Immunogen: SLC18A2 (NP_003045, 53 a.a. ~ 151 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Y
• Monoclonal or Polyclonal: Polyclonal
• Target Species: Human