solute carrier family 1 (glial high affinity glutamate transporter), member 2, Mouse, Clone: 4G8, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SLC1A2.

Supplier:  Abnova Corporation H00006506M10

Catalog No. 89-014-189

Description

This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq

Sequence: DEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDG

Specifications

• Antigen: solute carrier family 1 (glial high affinity glutamate transporter), member 2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_004171
• Gene Symbols: SLC1A2
• Immunogen: SLC1A2 (NP_004162, 160 a.a. ∼ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 4G8
• Description: Mouse monoclonal antibody raised against a partial recombinant SLC1A2.
• Gene: SLC1A2
• Gene Alias: EAAT2/GLT-1
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6506
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ