solute carrier family 1 (glial high affinity glutamate transporter), member 2, Mouse, Clone: 4G8, Abnova™

Catalog No.	Quantity
89-014-189	100 μg

Catalog No. 89-014-189 Supplier Abnova Corporation Supplier No. H00006506M10

Description

Mouse monoclonal antibody raised against a partial recombinant SLC1A2.

This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq

Sequence: DEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDG

Specifications

• Antigen: solute carrier family 1 (glial high affinity glutamate transporter), member 2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4G8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SLC1A2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SLC1A2
• Gene Accession No.: NM_004171
• Gene Alias: EAAT2/GLT-1
• Gene Symbols: SLC1A2
• Host Species: Mouse
• Immunogen: SLC1A2 (NP_004162, 160 a.a. ∼ 239 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 6506
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ