solute carrier family 22 (organic cation/ergothioneine transporter), member 4, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-314	50 μL

Catalog No. 89-004-314 Supplier Abnova Corporation Supplier No. H00006583A01

Description

Mouse polyclonal antibody raised against a partial recombinant SLC22A4.

Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is an organic cation transporter and plasma integral membrane protein containing eleven putative transmembrane domains as well as a nucleotide-binding site motif. Transport by this protein is at least partially ATP-dependent. [provided by RefSeq

Sequence: AGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK

Specifications

• Antigen: solute carrier family 22 (organic cation/ergothioneine transporter), member 4
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SLC22A4.
• Formulation: 50% glycerol
• Gene: SLC22A4
• Gene Accession No.: NM_003059
• Gene Alias: MGC34546/MGC40524/OCTN1
• Gene Symbols: SLC22A4
• Host Species: Mouse
• Immunogen: SLC22A4 (NP_003050, 43 a.a. ∼ 141 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6583
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum