Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC38A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159650
Description
SLC38A1 Polyclonal specifically detects SLC38A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SLC38A1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Amino acid transporter A1, ATA1SNAT1, NAT2N-system amino acid transporter 2, SAT1amino acid transporter system A1, sodium-coupled neutral amino acid transporter 1, Solute carrier family 38 member 1, solute carrier family 38, member 1, System A amino acid transporter 1, System N amino acid transporter 1 | |
Rabbit | |
54 kDa | |
100 μL | |
Primary | |
Mouse 85%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
Purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
1 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
Q9H2Q2 | |
SLC38A1 | |
Synthetic peptides corresponding to SLC38A1(solute carrier family 38, member 1) The peptide sequence was selected from the middle region of SLC38A1. Peptide sequence DRSQKKMQMVSNISFFAMFVMYFLTAIFGYLTFYDNVQSDLLHKYQSKDD. | |
Protein A purified | |
RUO | |
81539 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction