solute carrier family 45, member 2, Mouse, Clone: 1B2, Abnova™

Catalog No.	Quantity
89-001-275	100 μg

Catalog No. 89-001-275 Supplier Abnova Corporation Supplier No. H00051151M02

Description

Mouse monoclonal antibody raised against a full-length recombinant SLC45A2.

This gene encodes a transporter protein that mediates melanin synthesis. The protein is expressed in a high percentage of melanoma cell lines. Mutations in this gene are a cause of oculocutaneous albinism type 4, and polymorphisms in this gene are associated with variations in skin and hair color. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MGSNSGQAGRHIYKSLADDGPFDSVEPPKRPTSRLIMHSMAMFGREFCYAVEAAYVTPVLLSVGLPSSLYSIVWFLSPILGFLLQPVVGSASDHCRSRWGRRRPYILTLGVMMLVGMALYLNGATVVAALIANPRRKLVWAISVTMIGVVLFDFAADFIDGPIKAYLFDVCSHQDKEKGLHYHALFTDSQGNDIKVTAESTGEHASSLPLPLHQPPHWMDGLPVQHAVLHRFHGPDCVPRGSL

Specifications

• Antigen: solute carrier family 45, member 2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1B2
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant SLC45A2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SLC45A2
• Gene Accession No.: BC003597
• Gene Alias: 1A1/AIM1/MATP/SHEP5
• Gene Symbols: SLC45A2
• Host Species: Mouse
• Immunogen: SLC45A2 (AAH03597, 1 a.a. ∼ 243 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 51151
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ