SMAD family member 1, Mouse, Clone: 1D3, Abnova™

Catalog No.	Quantity
89-000-783	100 μg

Catalog No. 89-000-783 Supplier Abnova Corporation Supplier No. H00004086M02

Description

Mouse monoclonal antibody raised against a partial recombinant SMAD1.

The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, this protein can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of this protein forms a complex with SMAD4, which is important for its function in the transcription regulation. This protein is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq]

Sequence: MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCE

Specifications

• Antigen: SMAD family member 1
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 1D3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SMAD1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SMAD1
• Gene Accession No.: NM_005900
• Gene Alias: BSP1/JV4-1/JV41/MADH1/MADR1
• Gene Symbols: SMAD1
• Host Species: Mouse
• Immunogen: SMAD1 (NP_005891, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Membrane Receptors
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 4086
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ