SMAD family member 2, Mouse, Clone: 3G9, Abnova™

Catalog No.	Quantity
89-000-784	100 μg

Catalog No. 89-000-784 Supplier Abnova Corporation Supplier No. H00004087M05

Description

Mouse monoclonal antibody raised against a partial recombinant SMAD2.

The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signal of the transforming growth factor (TGF)-beta, and thus regulates multiple cellular processes, such as cell proliferation, apoptosis, and differentiation. This protein is recruited to the TGF-beta receptors through its interaction with the SMAD anchor for receptor activation (SARA) protein. In response to TGF-beta signal, this protein is phosphorylated by the TGF-beta receptors. The phosphorylation induces the dissociation of this protein with SARA and the association with the family member SMAD4. The association with SMAD4 is important for the translocation of this protein into the nucleus, where it binds to target promoters and forms a transcription repressor complex with other cofactors. This protein can also be phosphorylated by activin type 1 receptor kinase, and mediates the signal from the activin. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq]

Sequence: PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYY

Specifications

• Antigen: SMAD family member 2
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 3G9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SMAD2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SMAD2
• Gene Accession No.: BC025699
• Gene Alias: JV18/JV18-1/MADH2/MADR2/MGC22139/MGC34440/hMAD-2/hSMAD2
• Gene Symbols: SMAD2
• Host Species: Mouse
• Immunogen: SMAD2 (AAH25699, 181 a.a. ∼ 280 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 4087
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ