SMAD family member 6, Mouse, Clone: 2A8, Abnova™

Catalog No.	Quantity
89-000-788	100 μg

Catalog No. 89-000-788 Supplier Abnova Corporation Supplier No. H00004091M06

Description

Mouse monoclonal antibody raised against a partial recombinant SMAD6.

The protein encoded by this gene belongs to the SMAD family of proteins, which are related to Drosophila 'mothers against decapentaplegic' (Mad) and C. elegans Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions in the negative regulation of BMP and TGF-beta/activin-signalling. Multiple transcript variants encoding different isoforms have been found for this gene

Sequence: RDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVYDQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTR

Specifications

• Antigen: SMAD family member 6
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2A8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SMAD6.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SMAD6
• Gene Accession No.: NM_005585
• Gene Alias: HsT17432/MADH6/MADH7
• Gene Symbols: SMAD6
• Host Species: Mouse
• Immunogen: SMAD6 (NP_005576, 285 a.a. ∼ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Membrane Receptors
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 4091
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ