SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SMARCA4.

Supplier:  Abnova Corporation H00006597A01

Catalog No. 89-018-841

Description

The protein encoded by this gene is a member of the SWI/SNF family of proteins and is similar to the brahma protein of Drosophila. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. In addition, this protein can bind BRCA1, as well as regulate the expression of the tumorigenic protein CD44. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: LSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDS

Specifications

• Antigen: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant SMARCA4.
• Gene: SMARCA4
• Gene Alias: BAF190/BRG1/FLJ39786/SNF2/SNF2-BETA/SNF2L4/SNF2LB/SWI2/hSNF2b
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Transcription Regulation
• Gene ID (Entrez): 6597
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_003072
• Gene Symbols: SMARCA4
• Immunogen: SMARCA4 (NP_003063, 1451 a.a. ∼ 1550 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum