Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SMARCA5.

Manufacturer:  Abnova Corporation H00008467A01

Catalog No. 89-004-391


Add to cart

Description

Description

The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The protein encoded by this gene is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II. The encoded protein is similar in sequence to the Drosophila ISWI chromatin remodeling protein. [provided by RefSeq

Sequence: EEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGDYRHRRTE
Specifications

Specifications

SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5
Unconjugated
50% glycerol
NM_003601
ISWI|SNF2H|WCRF135|hISWI|hSNF2H
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
8467
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant SMARCA5.
SMARCA5
Serum
SMARCA5
SMARCA5 (NP_003592, 59 a.a. ~ 147 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit