Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No. 89004391 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-391 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-391 Supplier Abnova Corporation Supplier No. H00008467A01
Add to Cart
Add to Cart

Mouse polyclonal antibody raised against a partial recombinant SMARCA5.

The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The protein encoded by this gene is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II. The encoded protein is similar in sequence to the Drosophila ISWI chromatin remodeling protein. [provided by RefSeq

Sequence: EEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGDYRHRRTE

Specifications

Antigen SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant SMARCA5.
Formulation 50% glycerol
Gene SMARCA5
Gene Accession No. NM_003601
Gene Alias ISWI/SNF2H/WCRF135/hISWI/hSNF2H
Gene Symbols SMARCA5
Host Species Mouse
Immunogen SMARCA5 (NP_003592, 59 a.a. ∼ 147 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 8467
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.