Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1, Mouse, Clone: 3E3, Abnova™

Catalog No. 89000966 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-966 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-966 Supplier Abnova Corporation Supplier No. H00006598M02
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant SMARCB1.

The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: YTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENA

Specifications

Antigen SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3E3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant SMARCB1.
Formulation PBS with no preservative; pH 7.4
Gene SMARCB1
Gene Accession No. NM_003073
Gene Alias BAF47/INI1/RDT/SNF5/SNF5L1/Sfh1p/Snr1/hSNFS
Gene Symbols SMARCB1
Host Species Mouse
Immunogen SMARCB1 (NP_003064, 81 a.a. ∼ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Cycle
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 6598
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.