SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3, Mouse, Clone: 5F12, Abnova™

Catalog No.	Quantity
89-000-968	100 μg

Catalog No. 89-000-968 Supplier Abnova Corporation Supplier No. H00006604M02

Description

Mouse monoclonal antibody raised against a partial recombinant SMARCD3.

The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq

Sequence: ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVVRNT

Specifications

• Antigen: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 5F12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SMARCD3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SMARCD3
• Gene Accession No.: NM_001003801
• Gene Alias: BAF60C/CRACD3/MGC111010/Rsc6p
• Gene Symbols: SMARCD3
• Host Species: Mouse
• Immunogen: SMARCD3 (NP_001003801, 385 a.a. ∼ 483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6604
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ