SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-316	50 μL

Catalog No. 89-004-316 Supplier Abnova Corporation Supplier No. H00006605A01

Description

Mouse polyclonal antibody raised against a partial recombinant SMARCE1.

The protein encoded by this gene is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptional activation of genes normally repressed by chromatin. The encoded protein, either alone or when in the SWI/SNF complex, can bind to 4-way junction DNA, which is thought to mimic the topology of DNA as it enters or exits the nucleosome. The protein contains a DNA-binding HMG domain, but disruption of this domain does not abolish the DNA-binding or nucleosome-displacement activities of the SWI/SNF complex. Unlike most of the SWI/SNF complex proteins, this protein has no yeast counterpart. [provided by RefSeq

Sequence: RYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAY

Specifications

• Antigen: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SMARCE1.
• Formulation: 50% glycerol
• Gene: SMARCE1
• Gene Accession No.: NM_003079
• Gene Alias: BAF57
• Gene Symbols: SMARCE1
• Host Species: Mouse
• Immunogen: SMARCE1 (NP_003070, 75 a.a. ∼ 142 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6605
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum