Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SMG1 homolog, phosphatidylinositol 3-kinase-related kinase (C. elegans), Mouse, Clone: 1A8, Abnova™

Catalog No. 89001222 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-222 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-222 Supplier Abnova Corporation Supplier No. H00023049M02
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant SMG1.

This gene encodes a protein involved in nonsense-mediated mRNA decay (NMD) as part of the mRNA surveillance complex. The protein has kinase activity and is thought to function in NMD by phosphorylating the regulator of nonsense transcripts 1 protein. Alternative spliced transcript variants have been described, but their full-length natures have not been determined. [provided by RefSeq

Sequence: PDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV

Specifications

Antigen SMG1 homolog, phosphatidylinositol 3-kinase-related kinase (C. elegans)
Applications ELISA, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 1A8
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant SMG1.
Formulation PBS with no preservative; pH 7.4
Gene SMG1
Gene Accession No. NM_014006
Gene Alias 61E3.4/ATX/KIAA0421/LIP
Gene Symbols SMG1
Host Species Mouse
Immunogen SMG1 (NP_055535, 2922 a.a. ∼ 3031 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Kinases
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 23049
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.