Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000969

smoothened homolog (Drosophila), Mouse, Clone: 1D9, Abnova™

Catalog No. 89000969 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-969 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-969 Supplier Abnova Corporation Supplier No. H00006608M11
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a full-length recombinant SMO.

Sequence: NLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTELMDADSDF

Specifications

Antigen smoothened homolog (Drosophila)
Applications ELISA, Western Blot
Classification Monoclonal
Clone 1D9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full-length recombinant SMO.
Formulation PBS with no preservative; pH 7.4
Gene SMO
Gene Accession No. NM_005631
Gene Alias Gx/SMOH
Gene Symbols SMO
Host Species Mouse
Immunogen SMO (NP_005622.1, 653 a.a. ∼ 787 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Membrane Receptors
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 6608
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.