SMAD specific E3 ubiquitin protein ligase 1, Mouse, Clone: 1D7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SMURF1.

Supplier:  Abnova Corporation H00057154M01

Catalog No. 89-014-324

Description

This gene encodes a ubiquitin ligase that is specific for receptor-regulated SMAD proteins in the bone morphogenetic protein (BMP) pathway. A similar protein in Xenopus is involved in embryonic pattern formation. Alternative splicing results in multiple transcript variants encoding different isoforms. An additional transcript variant has been identified, but its full length sequence has not been determined. [provided by RefSeq

Sequence: DSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIP

Specifications

• Antigen: SMAD specific E3 ubiquitin protein ligase 1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_020429
• Gene Symbols: SMURF1
• Immunogen: SMURF1 (NP_065162, 165 a.a. ∼ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Immunoprecipitation, Western Blot
• Clone: 1D7
• Description: Mouse monoclonal antibody raised against a partial recombinant SMURF1.
• Gene: SMURF1
• Gene Alias: KIAA1625
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57154
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ