snail homolog 2 (Drosophila), Mouse, Clone: 3C12, Abnova™

Catalog No.	Quantity
89-000-965	100 μg

Catalog No. 89-000-965 Supplier Abnova Corporation Supplier No. H00006591M05

Description

Mouse monoclonal antibody raised against a partial recombinant SNAI2.

This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects. [provided by RefSeq

Sequence: KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV

Specifications

• Antigen: snail homolog 2 (Drosophila)
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 3C12
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SNAI2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SNAI2
• Gene Accession No.: NM_003068
• Gene Alias: MGC10182/SLUG/SLUGH1/WS2D
• Gene Symbols: SNAI2
• Host Species: Mouse
• Immunogen: SNAI2 (NP_003059, 97 a.a. ∼ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6591
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG3 κ