Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

small nuclear RNA activating complex, polypeptide 4, 190kDa, Mouse, Clone: 1D1, Abnova™

Catalog No. 89000970 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-970 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-970 Supplier Abnova Corporation Supplier No. H00006621M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant SNAPC4.

Sequence: PADPPISEEERWGEASNDEDDPKDKTLPEDPETCLQLNMVYQEVIQEKLAEANLLLAQNREQQEELMRDLAGSKGTKVKDGKSLPPSTYMGHFMKPYFKDKVTGVGPPAN

Specifications

Antigen small nuclear RNA activating complex, polypeptide 4, 190kDa
Applications ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 1D1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant SNAPC4.
Formulation PBS with no preservative; pH 7.4
Gene SNAPC4
Gene Accession No. NM_003086
Gene Alias FLJ13451/PTFalpha/SNAP190
Gene Symbols SNAPC4
Host Species Mouse
Immunogen SNAPC4 (NP_003077, 53 a.a. ∼ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 6621
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.