synuclein, alpha (non A4 component of amyloid precursor), Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-018-874	100 μg

Catalog No. 89-018-874 Supplier Abnova Corporation Supplier No. H00006622D01P

Description

Rabbit polyclonal antibody raised against a full-length human SNCA protein.

Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Four alternatively spliced transcripts encoding two different isoforms have been identified for this gene. [provided by RefSeq]

Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Specifications

• Antigen: synuclein, alpha (non A4 component of amyloid precursor)
• Applications: In situ PLA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human SNCA protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SNCA
• Gene Accession No.: NM_000345
• Gene Alias: MGC110988/NACP/PARK1/PARK4/PD1
• Gene Symbols: SNCA
• Host Species: Rabbit
• Immunogen: SNCA (NP_000336.1, 1 a.a. ∼ 140 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Primary or Secondary: Primary
• Gene ID (Entrez): 6622
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG