Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89123117

SNCG, Mouse, Clone: 2C3, Abnova™

Catalog No. 89123117 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-123-117 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-123-117 Supplier Abnova Corporation Supplier No. H00006623M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant SNCG.

Summary: This gene encodes a member of the synuclein family of proteins which are believed to be involved in the pathogenesis of neurodegenerative diseases. Mutations in this gene have also been associated with breast tumor development. [provided by RefSeq

Sequence: KTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD

Specifications

Antigen SNCG
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2C3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant SNCG.
Formulation ascites with no preservative
Gene SNCG
Gene Accession No. BC014098
Gene Alias BCSG1/SR
Gene Symbols SNCG
Host Species Mouse
Immunogen SNCG (AAH14098, 21 a.a. ∼ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6623
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.