SOCS6, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-016-971	50 μg

Catalog No. 89-016-971 Supplier Abnova Corporation Supplier No. H00009306B01P

Description

Mouse polyclonal antibody raised against a full-length human SOCS6 protein.

The protein encoded by this gene contains a SH2 domain and a CIS homolog domain. The protein thus belongs to the cytokine-induced STAT inhibitor (CIS), also known as suppressor of cytokine signaling (SOCS) or STAT-induced STAT inhibitor (SSI), protein family. CIS family members are known to be cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by GM-CSF and EPO in hematopoietic cells. A high expression level of this gene was found in factor-independent chronic myelogenous leukemia (CML) and erythroleukemia (HEL) cell lines. [provided by RefSeq

Sequence: MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINGEDEKGGKNRSKSESLMGTLKRRLSAKQKSKGKAGTPSGSSADEDTFSSSSAPIVFKDVRAQRPIRSTSLRSHHYSPAPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSYCLDSSSPMEVSAVPPQVGGRAFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSPRAGHDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNSAPGVARVYDSVQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY

Specifications

• Antigen: SOCS6
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human SOCS6 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SOCS6
• Gene Accession No.: NM_004232
• Gene Alias: CIS4/HSPC060/SOCS4/SSI4/STAI4/STATI4
• Gene Symbols: SOCS6
• Host Species: Mouse
• Immunogen: SOCS6 (NP_004223.2, 1 a.a. ∼ 535 a.a) full-length human protein.
• Purification Method: Affinity chromatography
• Quantity: 50 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9306
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Purified
• Isotype: IgG