SORCS2, Mouse, Clone: 1D7, Abnova™

Catalog No.	Quantity
89-002-646	100 μg

Catalog No. 89-002-646 Supplier Abnova Corporation Supplier No. H00057537M03

Description

Mouse monoclonal antibody raised against a partial recombinant SORCS2.

This gene encodes one family member of vacuolar protein sorting 10 (VPS10) domain-containing receptor proteins. The VPS10 domain name comes from the yeast carboxypeptidase Y sorting receptor Vps10 protein. Members of this gene family are large with many exons but the CDS lengths are usually less than 3700 nt. Very large introns typically separate the exons encoding the VPS10 domain; the remaining exons are separated by much smaller-sized introns. These genes are strongly expressed in the central nervous system. [provided by RefSeq

Sequence: VLRVLDQFQVMPLQFSKELDAYNPNTPEWREDVGLVVTRLLSKETSVPQELLVTVVKPGLPTLADLYVLLPPPRPTRKRSLSSDKRLAAIQQVLNAQKI

Specifications

• Antigen: SORCS2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1D7
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SORCS2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SORCS2
• Gene Accession No.: NM_020777.1
• Gene Symbols: SORCS2
• Host Species: Mouse
• Immunogen: SORCS2 (NP_065828.1, 802 a.a. ∼ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 57537
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ