SORCS2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-162	50 μL

Catalog No. 89-003-162 Supplier Abnova Corporation Supplier No. H00057537A01

Description

Mouse polyclonal antibody raised against a partial recombinant SORCS2.

This gene encodes one family member of vacuolar protein sorting 10 (VPS10) domain-containing receptor proteins. The VPS10 domain name comes from the yeast carboxypeptidase Y sorting receptor Vps10 protein. Members of this gene family are large with many exons but the CDS lengths are usually less than 3700 nt. Very large introns typically separate the exons encoding the VPS10 domain; the remaining exons are separated by much smaller-sized introns. These genes are strongly expressed in the central nervous system. [provided by RefSeq

Sequence: VLRVLDQFQVMPLQFSKELDAYNPNTPEWREDVGLVVTRLLSKETSVPQELLVTVVKPGLPTLADLYVLLPPPRPTRKRSLSSDKRLAAIQQVLNAQKI

Specifications

• Antigen: SORCS2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SORCS2.
• Formulation: 50% glycerol
• Gene: SORCS2
• Gene Accession No.: NM_020777.1
• Gene Symbols: SORCS2
• Host Species: Mouse
• Immunogen: SORCS2 (NP_065828.1, 802 a.a. ∼ 900 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 57537
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid