SRY (sex determining region Y)-box 4, Mouse, Clone: 2C5, Abnova™

Catalog No.	Quantity
89-014-194	50 μg

Catalog No. 89-014-194 Supplier Abnova Corporation Supplier No. H00006659M01

Description

Mouse monoclonal antibody raised against a partial recombinant SOX4.

This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins, such as syndecan binding protein (syntenin). The protein may function in the apoptosis pathway leading to cell death as well as to tumorigenesis and may mediate downstream effects of parathyroid hormone (PTH) and PTH-related protein (PTHrP) in bone development. The solution structure has been resolved for the HMG-box of a similar mouse protein. [provided by RefSeq

Sequence: KADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKS

Specifications

• Antigen: SRY (sex determining region Y)-box 4
• Applications: ELISA
• Classification: Monoclonal
• Clone: 2C5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SOX4.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SOX4
• Gene Accession No.: NM_003107
• Gene Alias: EVI16
• Gene Symbols: SOX4
• Host Species: Mouse
• Immunogen: SOX4 (NP_003098, 45 a.a. ∼ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 50 μg
• Regulatory Status: RUO
• Research Discipline: Stem Cell Biology
• Primary or Secondary: Primary
• Gene ID (Entrez): 6659
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ