SRY (sex determining region Y)-box 6, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-668	50 μL

Catalog No. 89-004-668 Supplier Abnova Corporation Supplier No. H00055553A01

Description

Mouse polyclonal antibody raised against a partial recombinant SOX6.

This gene encodes a member of the D subfamily of sex determining region y-related transcription factors that are characterized by a conserved DNA-binding domain termed the high mobility group box and by their ability to bind the minor groove of DNA. The encoded protein is a transcriptional activator that is required for normal development of the central nervous system, chondrogenesis and maintenance of cardiac and skeletal muscle cells. The encoded protein interacts with other family members to cooperatively activate gene expression. Alternative splicing results in multiple transcript variants

Sequence: MSSKQATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNKPHSEELPTLVSTIQQDADWDSVLSSQQRMESENNKLCSLYSFRNTSTSPHKPDEGSRDR

Specifications

• Antigen: SRY (sex determining region Y)-box 6
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SOX6.
• Formulation: 50% glycerol
• Gene: SOX6
• Gene Accession No.: NM_033326
• Gene Alias: HSSOX6
• Gene Symbols: SOX6
• Host Species: Mouse
• Immunogen: SOX6 (NP_201583, 1 a.a. ∼ 109 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 55553
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum