SRY (sex determining region Y)-box 9, Mouse, Clone: 3C10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SOX9.

Supplier:  Abnova Corporation H00006662M02

Catalog No. 89-000-971

Description

The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. [provided by RefSeq

Sequence: EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP

Specifications

• Antigen: SRY (sex determining region Y)-box 9
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_000346
• Gene Symbols: SOX9
• Immunogen: SOX9 (NP_000337, 400 a.a. ∼ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Immunoprecipitation, Western Blot
• Clone: 3C10
• Description: Mouse monoclonal antibody raised against a partial recombinant SOX9.
• Gene: SOX9
• Gene Alias: CMD1/CMPD1/SRA1
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 6662
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ