SP110 nuclear body protein, Mouse, Clone: 6F11, Abnova™

Catalog No.	Quantity
89-000-743	100 μg

Catalog No. 89-000-743 Supplier Abnova Corporation Supplier No. H00003431M02

Description

Mouse monoclonal antibody raised against a partial recombinant SP110.

The nuclear body is a multiprotein complex that may have a role in the regulation of gene transcription. This gene is a member of the SP100/SP140 family of nuclear body proteins and encodes a leukocyte-specific nuclear body component. The protein can function as an activator of gene transcription and may serve as a nuclear hormone receptor coactivator. In addition, it has been suggested that the protein may play a role in ribosome biogenesis and in the induction of myeloid cell differentiation. Alternative splicing has been observed for this gene and three transcript variants, encoding distinct isoforms, have been identified. [provided by RefSeq

Sequence: TPSDKKGKKRKRCIWSTPKRRHKKKSLPRGTASSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEEIIDGTSEMNEGKRSQKTPSTPRRVTQGAAS

Specifications

• Antigen: SP110 nuclear body protein
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 6F11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SP110.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SP110
• Gene Accession No.: NM_004510
• Gene Alias: FLJ22835/IFI41/IFI75/IPR1/VODI
• Gene Symbols: SP110
• Host Species: Mouse
• Immunogen: SP110 (NP_004501, 271 a.a. ∼ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3431
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ