sperm associated antigen 6, Mouse, Clone: 3E3, Abnova™

Catalog No.	Quantity
89-014-241	100 μg

Catalog No. 89-014-241 Supplier Abnova Corporation Supplier No. H00009576M01

Description

Mouse monoclonal antibody raised against a partial recombinant SPAG6.

The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm antibodies from an infertile man. This protein localizes to the tail of permeabilized human sperm and contains eight contiguous armadillo repeats, a motif known to mediate protein-protein interactions. Studies in mice suggest that this protein is involved in sperm flagellar motility and maintenance of the structural integrity of mature sperm. Alternatively spliced variants that encode different protein isoforms have been described but the full-length sequences of only two have been determined. [provided by RefSeq

Sequence: MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQNAGVMSLLRTLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKCDILPQLVYSLAEQNRFYK*

Specifications

• Antigen: sperm associated antigen 6
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 3E3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SPAG6.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SPAG6
• Gene Accession No.: NM_012443
• Gene Alias: DKFZp434I153/MGC26276/Repro-SA-1/pf16
• Gene Symbols: SPAG6
• Host Species: Mouse
• Immunogen: SPAG6 (NP_036575, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9576
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG3 κ