spastic paraplegia 21 (autosomal recessive, Mast syndrome), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-626	50 μL

Catalog No. 89-004-626 Supplier Abnova Corporation Supplier No. H00051324A01

Description

Mouse polyclonal antibody raised against a partial recombinant SPG21.

The protein encoded by this gene was identified by a two-hybrid screen using CD4 as the bait. It binds to the hydrophobic C-terminal amino acids of CD4 which are involved in repression of T cell activation. The interaction with CD4 is mediated by the noncatalytic alpha/beta hydrolase fold domain of this protein. It is thus proposed that this gene product modulates the stimulatory activity of CD4. At least three different transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq

Sequence: PHKIRDIPVTIMDVFDQSALSTEAKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQE

Specifications

• Antigen: spastic paraplegia 21 (autosomal recessive, Mast syndrome)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SPG21.
• Formulation: 50% glycerol
• Gene: SPG21
• Gene Accession No.: NM_016630
• Gene Alias: ACP33/BM-019/GL010/MASPARDIN/MAST
• Gene Symbols: SPG21
• Host Species: Mouse
• Immunogen: SPG21 (NP_057714, 211 a.a. ∼ 306 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 51324
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum