Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Our pricing system is unavailable. You are viewing list price.
Please call 1-800-766-7000 to place your order or try our site again later.

SPG3A, Mouse, Clone: 1B11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SPG3A.

Manufacturer:  Abnova Corporation H00051062M10

Catalog No. 89-002-630



Description

Description

The protein encoded by this gene is a GTPase and a Golgi body transmembrane protein. The encoded protein can form a homotetramer and has been shown to interact with spastin and with mitogen-activated protein kinase kinase kinase kinase 4. This protein may be involved in axonal maintenance as evidenced by the fact that defects in this gene are a cause of spastic paraplegia type 3. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq

Sequence: MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWV
Specifications

Specifications

SPG3A
1B11
Mouse monoclonal antibody raised against a partial recombinant SPG3A.
ATL1
Liquid
ATL1
SPG3A (NP_056999, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human, Rat
ELISA, Western Blot
Unconjugated
In 1X PBS, pH 7.4
NM_015915
AD-FSP|FSP1|GBP3|SPG3|SPG3A|atlastin1
Mouse
IgG1 Kappa
RUO
Primary
51062
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit