SPG3A, Mouse, Clone: 1B11, Abnova™

Catalog No.	Quantity
89-002-630	100 μg

Catalog No. 89-002-630 Supplier Abnova Corporation Supplier No. H00051062M10

Description

Mouse monoclonal antibody raised against a partial recombinant SPG3A.

The protein encoded by this gene is a GTPase and a Golgi body transmembrane protein. The encoded protein can form a homotetramer and has been shown to interact with spastin and with mitogen-activated protein kinase kinase kinase kinase 4. This protein may be involved in axonal maintenance as evidenced by the fact that defects in this gene are a cause of spastic paraplegia type 3. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq

Sequence: MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWV

Specifications

• Antigen: SPG3A
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1B11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SPG3A.
• Formulation: PBS with no preservative; pH 7.4
• Gene: ATL1
• Gene Accession No.: NM_015915
• Gene Alias: AD-FSP/FSP1/GBP3/SPG3/SPG3A/atlastin1
• Gene Symbols: ATL1
• Host Species: Mouse
• Immunogen: SPG3A (NP_056999, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 51062
• Target Species: Human, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ