spleen focus forming virus (SFFV) proviral integration oncogene spi1, Mouse, Clone: 2G1, Abnova™

Mouse monoclonal antibody raised against a partial recombinant SPI1.

Supplier:  Abnova Corporation H00006688M02

Catalog No. 89-000-976

Description

This gene encodes an ETS-domain transcription factor that activates gene expression during myeloid and B-lymphoid cell development. The nuclear protein binds to a purine-rich sequence known as the PU-box found near the promoters of target genes, and regulates their expression in coordination with other transcription factors and cofactors. The protein can also regulate alternative splicing of target genes. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSP

Specifications

• Antigen: spleen focus forming virus (SFFV) proviral integration oncogene spi1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_003120
• Gene Symbols: SPI1
• Immunogen: SPI1 (NP_003111, 1 a.a. ∼ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Western Blot
• Clone: 2G1
• Description: Mouse monoclonal antibody raised against a partial recombinant SPI1.
• Gene: SPI1
• Gene Alias: OF/PU.1/SFPI1/SPI-1/SPI-A
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 6688
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ