spleen focus forming virus (SFFV) proviral integration oncogene spi1, Mouse, Clone: 2G1, Abnova™

Catalog No.	Quantity
89-000-976	100 μg

Catalog No. 89-000-976 Supplier Abnova Corporation Supplier No. H00006688M02

Description

Mouse monoclonal antibody raised against a partial recombinant SPI1.

This gene encodes an ETS-domain transcription factor that activates gene expression during myeloid and B-lymphoid cell development. The nuclear protein binds to a purine-rich sequence known as the PU-box found near the promoters of target genes, and regulates their expression in coordination with other transcription factors and cofactors. The protein can also regulate alternative splicing of target genes. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSP

Specifications

• Antigen: spleen focus forming virus (SFFV) proviral integration oncogene spi1
• Applications: ELISA, Immunofluorescence, Western Blot
• Classification: Monoclonal
• Clone: 2G1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SPI1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SPI1
• Gene Accession No.: NM_003120
• Gene Alias: OF/PU.1/SFPI1/SPI-1/SPI-A
• Gene Symbols: SPI1
• Host Species: Mouse
• Immunogen: SPI1 (NP_003111, 1 a.a. ∼ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6688
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ