Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

spleen focus forming virus (SFFV) proviral integration oncogene spi1, Mouse, Clone: 2G1, Abnova™

Catalog No. 89000976 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-976 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-976 Supplier Abnova Corporation Supplier No. H00006688M02
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant SPI1.

This gene encodes an ETS-domain transcription factor that activates gene expression during myeloid and B-lymphoid cell development. The nuclear protein binds to a purine-rich sequence known as the PU-box found near the promoters of target genes, and regulates their expression in coordination with other transcription factors and cofactors. The protein can also regulate alternative splicing of target genes. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSP

Specifications

Antigen spleen focus forming virus (SFFV) proviral integration oncogene spi1
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 2G1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant SPI1.
Formulation PBS with no preservative; pH 7.4
Gene SPI1
Gene Accession No. NM_003120
Gene Alias OF/PU.1/SFPI1/SPI-1/SPI-A
Gene Symbols SPI1
Host Species Mouse
Immunogen SPI1 (NP_003111, 1 a.a. ∼ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 6688
Target Species Human, Mouse
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.