serine peptidase inhibitor-like, with Kunitz and WAP domains 1 (eppin), Mouse, Clone: 4G3, Abnova™

Catalog No.	Quantity
89-001-547	200 μL

Catalog No. 89-001-547 Supplier Abnova Corporation Supplier No. H00057119M02A

Description

Mouse monoclonal antibody raised against a partial recombinant SPINLW1.

This gene encodes an epididymal protease inhibitor, which contains both kunitz-type and WAP-type four-disulfide core (WFDC) protease inhibitor consensus sequences. Most WFDC genes are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene is a member of the WFDC gene family and belongs to the telomeric cluster. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq

Sequence: PGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP

Specifications

• Antigen: serine peptidase inhibitor-like, with Kunitz and WAP domains 1 (eppin)
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4G3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SPINLW1.
• Formulation: ascites with no preservative
• Gene: SPINLW1
• Gene Accession No.: NM_020398
• Gene Alias: EPPIN/EPPIN1/EPPIN2/EPPIN3/WAP7/WFDC7/dJ461P17.2
• Gene Symbols: SPINLW1
• Host Species: Mouse
• Immunogen: SPINLW1 (NP_065131, 22 a.a. ∼ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 57119
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ