sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SPR.

Supplier:  Abnova Corporation H00006697A01

Catalog No. 89-004-321

Description

This gene encodes an aldo-keto reductase that catalyzes the NADPH-dependent reduction of pteridine derivatives and is important in the biosynthesis of tetrahydrobiopterin (BH4). Mutations in this gene result in DOPA-responsive dystonia due to sepiaterin reductase deficiency. A pseudogene has been identified on chromosome 1. [provided by RefSeq

Sequence: FKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYD

Specifications

• Antigen: sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant SPR.
• Gene: SPR
• Gene Alias: SDR38C1
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 6697
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_003124
• Gene Symbols: SPR
• Immunogen: SPR (NP_003115, 164 a.a. ∼ 260 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum