serine palmitoyltransferase, long chain base subunit 2, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-443	50 μL

Catalog No. 89-004-443 Supplier Abnova Corporation Supplier No. H00009517A01

Description

Mouse polyclonal antibody raised against a partial recombinant SPTLC2.

This gene encodes a long chain base subunit of serine palmitoyltransferase. Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It catalyzes the pyridoxal-5-prime-phosphate-dependent condensation of L-serine and palmitoyl-CoA to 3-oxosphinganine. Mutations in this gene were identified in patients with hereditary sensory neuropathy type I. Alternatively spliced variants encoding different isoforms have been identified. [provided by RefSeq

Sequence: LKEMGFIIYGNEDSPVVPLMLYMPAKIGAFGREMLKRNIGVVVVGFPATPIIESRARFCLSAAHTKEILDTALKEIDEVGDLLQLKYSRHRLVPLLDRPFDETTYEETE

Specifications

• Antigen: serine palmitoyltransferase, long chain base subunit 2
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant SPTLC2.
• Formulation: 50% glycerol
• Gene: SPTLC2
• Gene Accession No.: NM_004863
• Gene Alias: KIAA0526/LCB2/SPT2
• Gene Symbols: SPTLC2
• Host Species: Mouse
• Immunogen: SPTLC2 (NP_004854, 453 a.a. ∼ 561 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 9517
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum