steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2), Mouse, Clone: 1F4, Abnova™

Catalog No.	Quantity
89-000-978	100 μg

Catalog No. 89-000-978 Supplier Abnova Corporation Supplier No. H00006716M01

Description

Mouse monoclonal antibody raised against a partial recombinant SRD5A2.

This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH). [provided by RefSeq

Sequence: AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA

Specifications

• Antigen: steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1F4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SRD5A2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SRD5A2
• Gene Accession No.: NM_000348
• Gene Alias: MGC138457
• Gene Symbols: SRD5A2
• Host Species: Mouse
• Immunogen: SRD5A2 (NP_000339.2, 28 a.a. ∼ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6716
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ