sterol regulatory element binding transcription factor 1, Mouse, Clone: 4C11, Abnova™

Catalog No.	Quantity
89-000-979	100 μg

Catalog No. 89-000-979 Supplier Abnova Corporation Supplier No. H00006720M02

Description

Mouse monoclonal antibody raised against a partial recombinant SREBF1.

This gene encodes a transcription factor that binds to the sterol regulatory element-1 (SRE1), which is a decamer flanking the low density lipoprotein receptor gene and some genes involved in sterol biosynthesis. The protein is synthesized as a precursor that is attached to the nuclear membrane and endoplasmic reticulum. Following cleavage, the mature protein translocates to the nucleus and activates transcription by binding to the SRE1. Sterols inhibit the cleavage of the precursor, and the mature nuclear form is rapidly catabolized, thereby reducing transcription. The protein is a member of the basic helix-loop-helix-leucine zipper (bHLH-Zip) transcription factor family. This gene is located within the Smith-Magenis syndrome region on chromosome 17. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: VTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL

Specifications

• Antigen: sterol regulatory element binding transcription factor 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4C11
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SREBF1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SREBF1
• Gene Accession No.: BC057388
• Gene Alias: SREBP-1c/SREBP1/bHLHd1
• Gene Symbols: SREBF1
• Host Species: Mouse
• Immunogen: SREBF1 (AAH57388, 801 a.a. ∼ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6720
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ