Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

sterol regulatory element binding transcription factor 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant SREBF2.

Manufacturer:  Abnova Corporation H00006721A01

Catalog No. 89-004-322


Add to cart

Description

Description

This gene encodes a ubiquitously expressed transcription factor that controls cholesterol homeostasis by stimulating transcription of sterol-regulated genes. The encoded protein contains a basic helix-loop-helix-leucine zipper (bHLH-Zip) domain. [provided by RefSeq

Sequence: QAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEYLKLLHSFVDSVGVMSPPLSRSSVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFT
Specifications

Specifications

sterol regulatory element binding transcription factor 2
Unconjugated
50% glycerol
BC056158
SREBP2|bHLHd2
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
6721
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant SREBF2.
SREBF2
Serum
SREBF2
SREBF2 (AAH56158, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit