Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89006924

synovial sarcoma, X breakpoint 3, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89006924 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-006-924 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-006-924 Supplier Abnova Corporation Supplier No. H00010214B01

Description

Mouse polyclonal antibody raised against a full-length human SSX3 protein.

The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This gene appears not to be involved in this type of chromosome translocation. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq

Sequence: MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTKLGFKAILPSFMRNKRVTDFQGNDFDNDPNRGNQVQRPQMTFGRLQGIFPKIMPKKPAEEGNVSKEVPEASGPQNDGKQLCPPGKPTTSEKINMISGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE

Specifications

Antigen synovial sarcoma, X breakpoint 3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description synovial sarcoma, X breakpoint 3
Formulation No additive
Gene SSX3
Gene Accession No. NM_021014.2
Gene Alias MGC119054, MGC14495
Gene Symbols SSX3
Host Species Mouse
Immunogen SSX3 (NP_066294.1, 1 a.a. ∽188 a.a) full-length human protein.
Quantity 50 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 10214
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.