ST3 beta-galactoside alpha-2,3-sialyltransferase 4, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ST3GAL4.

Supplier:  Abnova Corporation H00006484A01

Catalog No. 89-004-309

Description

Synthesis of alpha-2,3-linked sialic acid to Gal(beta-1,3)GalNAc is mediated by at least 3 distinct beta-galactoside alpha-2,3-sialyltransferases (EC 2.4.99.4), including ST3GAL4. In contrast, only a single gene encodes the beta-galactoside alpha-2,6-sialyltransferase (EC 2.4.99.1), ST6GAL1 (MIM 109675) (Chang et al., 1995 [PubMed 7655169]).[supplied by OMIM

Sequence: FYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSL

Specifications

• Antigen: ST3 beta-galactoside alpha-2,3-sialyltransferase 4
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant ST3GAL4.
• Gene: ST3GAL4
• Gene Alias: CGS23/FLJ11867/FLJ46764/NANTA3/SAT3/SIAT4/SIAT4C/ST3GalIV/STZ
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 6484
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_006278
• Gene Symbols: ST3GAL4
• Immunogen: ST3GAL4 (NP_006269, 31 a.a. ∼ 130 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum