stabilin 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-556	50 μL

Catalog No. 89-004-556 Supplier Abnova Corporation Supplier No. H00023166A01

Description

Mouse polyclonal antibody raised against a partial recombinant STAB1.

This gene encodes a large, transmembrane receptor protein which may function in angiogenesis, lymphocyte homing, cell adhesion, or receptor scavenging. The protein contains 7 fasciclin, 16 epidermal growth factor (EGF)-like, and 2 laminin-type EGF-like domains as well as a C-type lectin-like hyaluronan-binding Link module. The protein is primarily expressed on sinusoidal endothelial cells of liver, spleen, and lymph node. The receptor has been shown to endocytose ligands such as low density lipoprotein, Gram-positive and Gram-negative bacteria, and advanced glycosylation end products. Supporting its possible role as a scavenger receptor, the protein rapidly cycles between the plasma membrane and early endosomes. [provided by RefSeq

Sequence: EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQ

Specifications

• Antigen: stabilin 1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant STAB1.
• Formulation: 50% glycerol
• Gene: STAB1
• Gene Accession No.: NM_015136
• Gene Alias: CLEVER-1/FEEL-1/FELE-1/FEX1/KIAA0246/STAB-1
• Gene Symbols: STAB1
• Host Species: Mouse
• Immunogen: STAB1 (NP_055951, 1804 a.a. ∼ 1902 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 23166
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum