StAR-related lipid transfer (START) domain containing 4, Mouse, MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-015-811	50 μL

Catalog No. 89-015-811 Supplier Abnova Corporation Supplier No. H00134429B01

Description

Mouse polyclonal antibody raised against a full-length human STARD4 protein.

Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD4 (Soccio et al., 2002 [PubMed 12011452]).[supplied by OMIM

Sequence: MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHIRPGPCRLDWDSLMTSLDILENFEENCCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGISLDWDEKRPEFVRGYNHPCGWFCVPLKDNPNQSLLTGYIQTDLRGMIPQSAVDTAMASTLTNFYGDLRKAL

Specifications

• Antigen: StAR-related lipid transfer (START) domain containing 4
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human STARD4 protein.
• Formulation: No additive
• Gene: STARD4
• Gene Accession No.: NM_139164
• Gene Symbols: STARD4
• Host Species: Mouse
• Immunogen: STARD4 (NP_631903.1, 1 a.a. ∼ 205 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 134429
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum