signal transducer and activator of transcription 3 (acute-phase response factor), Mouse, Clone: 4D6, Abnova™

Catalog No.	Quantity
89-000-984	100 μg

Catalog No. 89-000-984 Supplier Abnova Corporation Supplier No. H00006774M02

Description

Mouse monoclonal antibody raised against a partial recombinant STAT3.

The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Three alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq

Sequence: LVYLYPDIPKEEAFGKYCRPESQEHPEADPGAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM

Specifications

• Antigen: signal transducer and activator of transcription 3 (acute-phase response factor)
• Applications: ELISA, Immunofluorescence, In situ PLA, Western Blot
• Classification: Monoclonal
• Clone: 4D6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant STAT3.
• Formulation: PBS with no preservative; pH 7.4
• Gene: STAT3
• Gene Accession No.: NM_003150
• Gene Alias: APRF/FLJ20882/HIES/MGC16063
• Gene Symbols: STAT3
• Host Species: Mouse
• Immunogen: STAT3 (NP_003141, 670 a.a. ∼ 769 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Membrane Receptors
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6774
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ