Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

STAT3 Rabbit anti-Human, Mouse, Rat, Polyclonal, MilliporeSigma™

Rabbit Polyclonal Antibody

Manufacturer:  MilliporeSigma 06596

Catalog No. 06-596-MI

Add to cart



Anti-STAT3 Antibody is a Rabbit Polyclonal Antibody for detection of STAT3 also known as Acute-phase response factor or DNA-binding protein APRF and has been validated in Chimmunoprecipitation, EMSA, immunocytochemistry, immunoprecipitation and western blotting.


Electromobility Shift Assay, Immunocytochemistry, Immunoprecipitation, Western Blot
Protein A purified rabbit IgG in 200 L of 0.1M Tris-glycine, pH 7.4, 0.15M NaCl, 0.05% sodium azide. Frozen at −20°C.
APRF; FLJ20882; HIES; MGC16063
Bacterially expressed GST fusion protein corresponding to a.a. 688-722 of human STAT 3 (RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B.
Protein A purfied
−20°C in undiluted aliquotes for up to 12 months, Avoid repeated freeze/thaw cycles.
Human, Murine, Rat
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only