Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 06596MI

STAT3 Rabbit anti-Human, Mouse, Rat, Polyclonal, MilliporeSigma™

Catalog No. 06596MI Shop All MilliporeSigma Products
Change view
Click to view available options
Quantity:
200 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
06-596-MI 200 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 06-596-MI Supplier MilliporeSigma Supplier No. 06596
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Anti-STAT3 Antibody is a Rabbit Polyclonal Antibody for detection of STAT3 also known as Acute-phase response factor or DNA-binding protein APRF and has been validated in Chimmunoprecipitation, EMSA, immunocytochemistry, immunoprecipitation and western blotting.
TRUSTED_SUSTAINABILITY

Specifications

Antigen STAT3
Applications Electromobility Shift Assay, Immunocytochemistry, Immunoprecipitation, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation Protein A purified rabbit IgG in 200 L of 0.1M Tris-glycine, pH 7.4, 0.15M NaCl, 0.05% sodium azide. Frozen at −20°C.
Gene Symbols APRF; FLJ20882; HIES; MGC16063
Host Species Rabbit
Immunogen Bacterially expressed GST fusion protein corresponding to a.a. 688-722 of human STAT 3 (RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B.
Purification Method Protein A purfied
Quantity 200 μg
Primary or Secondary Primary
Gene ID (Entrez) NM_139276
Target Species Human, Mouse, Rat
Content And Storage -20°C in undiluted aliquots for up to 12 months, Avoid Freeze/Thaw Cycles
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.