signal transducer and activator of transcription 5B, Mouse, Clone: 2D1, Abnova™

Catalog No.	Quantity
89-000-986	100 μg

Catalog No. 89-000-986 Supplier Abnova Corporation Supplier No. H00006777M03

Description

Mouse monoclonal antibody raised against a partial recombinant STAT5B.

The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. This gene was found to fuse to retinoic acid receptor-alpha (RARA) gene in a small subset of acute promyelocytic leukemias (APLL). The dysregulation of the signaling pathways mediated by this protein may be the cause of the APLL. [provided by RefSeq

Sequence: VYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHAQS

Specifications

• Antigen: signal transducer and activator of transcription 5B
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 2D1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant STAT5B.
• Formulation: PBS with no preservative; pH 7.4
• Gene: STAT5B
• Gene Accession No.: NM_012448
• Gene Alias: STAT5
• Gene Symbols: STAT5B
• Host Species: Mouse
• Immunogen: STAT5B (NP_036580, 678 a.a. ∼ 787 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Signal Transduction
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6777
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG1 κ